Protein Info for mRNA_6356 in Rhodosporidium toruloides IFO0880

Name: 14724
Annotation: K01477 alc, ALLC allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 TIGR02961: allantoicase" amino acids 33 to 348 (316 residues), 322.8 bits, see alignment E=9.1e-101 PF03561: Allantoicase" amino acids 42 to 188 (147 residues), 128.9 bits, see alignment E=1.5e-41 amino acids 212 to 347 (136 residues), 137 bits, see alignment E=4.8e-44 PF04115: Ureidogly_lyase" amino acids 393 to 587 (195 residues), 159.9 bits, see alignment E=6.3e-51

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>mRNA_6356 K01477 alc, ALLC allantoicase (Rhodosporidium toruloides IFO0880)
MTAHAPYTAKLNGDTGAARPIPLDQFDSVFGSLIELSSEALGGKAVDVSDEFFCAAQNLL
KVPPSVSMKGQFGPNGALFDGWESRRHNPTYDWTIIKLGALGSIVGCDVDTGHFSGNESP
ASGVWGAYVPEGESIKEESPLWTPLLPVTPLGPAQRHLFLLSHPSSPVTHLKLTMHPDGG
LGRFRAYGHVIPPPPPAKPTGEAVDLAYVLNGGTVTGESDQHFGRGGNLILPGRGKDMGD
GWETRRSRGRLGTGKGDWVVVKLAEPGYLEWVDIDTLHFVGNFPNSAELYGIISNDTDAG
WTRILDNTKLGPHRHHYYQLSHPDKAWTHVRLDIHPDGGVKRLRLYGRPKSQYPDYSALV
PLPHPAEFEKTVNGAPNGISASHAPSFSRSVPKIPAVPLTPSAFAPYGSVIQSYPDERSA
PKEIKIKTVNFGTARKFNHLAPVEYVAPPAGRFGGKDVPEGQVNFCVFRCEPQNGVRRSE
AGKQQWDVKVLERHEFSTQAFVPMGGAKEGEGNYLVLVALPGPDGQPDLSTLRAFMASHS
QGISYHVNVWHHPLISLGNDKQDFACIVYETGVPEVDCEIKWFEEGTVAVVEEV