Protein Info for mRNA_6366 in Rhodosporidium toruloides IFO0880

Name: 14734
Annotation: BLAST putative membrane permease [Rhizoctonia solani 123E]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 201 to 216 (16 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 41% identity to cci:CC1G_07346)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>mRNA_6366 BLAST putative membrane permease [Rhizoctonia solani 123E] (Rhodosporidium toruloides IFO0880)
MPSTNHWNDHLPLKIVNLLTFAFLFSSNIYSAFTPHSYGRDTYFTPADYVFYTWTIIDVL
LLGFVIYQFFDDSTDIVHGIGWRFPLIGVLNAIFVHVFVTRHYIVALIFAILVASTVSTA
YYTLSAHYPARSIGDTVFVHLPFSLWHAWSIVLVLISAFALFTHGNHHTHPSVLSRILVV
AAEAFLALTAIGYAFRSREGDVAGAAVLAFTLYGIYDAQRDDVIRYCALAGFIVSLLSIV
KSLYFTFAGDRGVSLGTDDERRPLVA