Protein Info for mRNA_6373 in Rhodosporidium toruloides IFO0880

Name: 14741
Annotation: K03013 RPB5, POLR2E DNA-directed RNA polymerases I, II, and III subunit RPABC1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03871: RNA_pol_Rpb5_N
  • amino acids 6 to 92 (87 residues), 95.9 bits, E=1.8e-31
• PF01191: RNA_pol_Rpb5_C
  • amino acids 137 to 209 (73 residues), 115.9 bits, E=5.9e-38

Best Hits

Swiss-Prot: 55% identical to RPAB1_SCHPO: DNA-directed RNA polymerases I, II, and III subunit RPABC1 (rpb5) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K03013, DNA-directed RNA polymerases I, II, and III subunit RPABC1 (inferred from 60% identity to lbc:LACBIDRAFT_184892)

Predicted SEED Role

"DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase I or RNA polymerase II or RNA polymerase III (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (210 amino acids)

>mRNA_6373 K03013 RPB5, POLR2E DNA-directed RNA polymerases I, II, and III subunit RPABC1 (Rhodosporidium toruloides IFO0880)
MADEAERETARLFRVSRTAHELVRDRGYAIADEEIGMSLDDFKQQYAAGGTAIDKAKINF
SAAKEGAPEEQIYIFYAEEASVGIKTMRKFIDILESQKIPRGILIYKTSMTPSANKVITA
MAQQFTIEAFQESELLVNITHHVLVPKHEVLKPEEKKLLLQKYRLKDTQLPRIQLHDPVA
RYYGLKRGQVVKITRPSETAGRYVSYRLCL