Protein Info for mRNA_6405 in Rhodosporidium toruloides IFO0880

Name: 14773
Annotation: KOG0725 Reductases with broad range of substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00106: adh_short" amino acids 15 to 198 (184 residues), 146.9 bits, see alignment E=1.1e-46 PF08659: KR" amino acids 17 to 121 (105 residues), 32.6 bits, see alignment E=1.5e-11 PF13561: adh_short_C2" amino acids 20 to 243 (224 residues), 126 bits, see alignment E=3.8e-40 PF08643: DUF1776" amino acids 107 to 199 (93 residues), 23 bits, see alignment E=1e-08

Best Hits

KEGG orthology group: None (inferred from 59% identity to oca:OCAR_5505)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>mRNA_6405 KOG0725 Reductases with broad range of substrate specificities (Rhodosporidium toruloides IFO0880)
MAATSTRLPDATRRIACVTGASSGIGRACAIALAKEGWTVVISARRAADLDETVRLAKEA
RQEAEVRPLPGDLGKPEDVDSLFDFIRREYGRLDVLFNNAGRSVAPVPLEDVSLEDFQSI
VSLNLIAPFLATQHAFRIMKDQTPQGGRIINNGSISAHTPRPFSAPYTMTKHAITGLTKS
TALDGRAYNIACSQIDIGAGSNAESAMVGAMKPGGSLQPNGQRIQEPVMPVEHVADAVVH
MASLSLNVNILNQTIMATTMPFVGRG