Protein Info for mRNA_6493 in Rhodosporidium toruloides IFO0880

Name: 14861
Annotation: K20301 TRAPPC2, TRS20 trafficking protein particle complex subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF04628: Sedlin_N" amino acids 8 to 179 (172 residues), 120.2 bits, see alignment E=6.8e-39 PF04099: Sybindin" amino acids 112 to 176 (65 residues), 34.8 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 47% identity to lbc:LACBIDRAFT_399530)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>mRNA_6493 K20301 TRAPPC2, TRS20 trafficking protein particle complex subunit 2 (Rhodosporidium toruloides IFO0880)
MSYYLVLVGTLDNPLYEAFLTSSKASSSTTISVTAQSPSIPSSFSIFGALPTSSTPNPQG
TGTASTVGYGHKTGPNGRHVMQLVAHASLDVVEDVQWTNGGMYLKSVDKFHEWTVSAWLT
PGGVKIILLHELKNDEGIRLFLQDTWETYVKTLLNPFHELNAPIRNQTFDARIKASAKKH
L