Protein Info for mRNA_6497 in Rhodosporidium toruloides IFO0880

Name: 14865
Annotation: HMMPfam-Peptidase family M28-PF04389,SUPERFAMILY--SSF53187

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF04389: Peptidase_M28" amino acids 208 to 413 (206 residues), 102.7 bits, see alignment E=2.3e-33 PF01546: Peptidase_M20" amino acids 240 to 311 (72 residues), 28.5 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 51% identity to cne:CNI04080)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>mRNA_6497 HMMPfam-Peptidase family M28-PF04389,SUPERFAMILY--SSF53187 (Rhodosporidium toruloides IFO0880)
MVVSLLPLPRNGENRATMHFSIPLVAATLATLSSALPLQENQQLAFGTSGSTRQELAAAF
GSLPVKLAAKLEQHIASLPEQRLVKLGDDEESILITEGEKALLVLAGKRFIDVTEEDLTI
AVAEKQSFPSKLSYNTKALQSLFDDLSTSEMRRFLQSFTGFRTRYYRSDTGKQSQQFLLG
QIKQVAKSNKDLKIKVSEFQHSWGQNSIIARFEPSTSAHNVSDSVVIIGAHQDSTNLLPF
LAAPGADDDASGTTSILSAFKSLVHAGFQPSQHPVEFHWYSAEEGGLLGSQAVAQEYASR
GTKVRAMTQLDMTAYVKPGTEPRIGVIQDYVDPAFTKFLTTVAGEYAEIPTVETQCGYAC
SDHASWSKVGAPSAFMIESTFADSSKAIHSSQDTIDQPGYSLDHIKQFARVAIALAVELG
GGDSVVA