Protein Info for mRNA_6501 in Rhodosporidium toruloides IFO0880

Name: 14869
Annotation: K06902 UMF1 MFS transporter, UMF1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 371 to 395 (25 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details amino acids 498 to 521 (24 residues), see Phobius details amino acids 529 to 546 (18 residues), see Phobius details PF11700: ATG22" amino acids 45 to 558 (514 residues), 390.7 bits, see alignment E=9.3e-121

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>mRNA_6501 K06902 UMF1 MFS transporter, UMF1 family (Rhodosporidium toruloides IFO0880)
MLSRPPVEPPDSSLSDGEEAALLSRYGRTAGPFDTPEESEAAYTRQLWGVYAYSVASEVF
PIVTGTLLLPVLLETYARQNGVLAPERVVACPPSGLGGAAAGEGEEAARCVVRLAGVWLD
TASFSLMTYSASVFVQALTVISMGGLGDDPWMRHRLLTLFATSGSILCILFLFLPSASAI
WPLCTLLALGANVAFGASIVCLNSYLPDLGRRHPTVLLAQAALLNARQSYARHRRESVSS
SNTLLSASQHLARATDAYTAAKGKATGEISARAIAVGYGAGIAVLVALLPVLRWLGEGEV
DGTWPLRVGVAISGMWWMVGTVPASIWLRPSTSIVKFTNSTAKATSLRSHIVQGWRGLGK
MLREWRRLPSTFVFLGAWFILSDCFATITSTAILFAKTTLNLPTSSLVLVSILTPLAGLV
GALAFPILQHRLHLTTHRTLLLLVSLATIIPLWGLVALRTSTQMYLLACVFGAIYGAFQA
LMRACFSELIPTSQSAQWFGVYSVTDKGSSFLGPLLVAYVTQVTGDIRHGFWVILILLLA
SLPVLAKVDMRKGSEDAEAFDREIKALAADEEVLPEEVEDV