Protein Info for mRNA_6514 in Rhodosporidium toruloides IFO0880

Name: 14882
Annotation: KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF03151: TPT" amino acids 64 to 404 (341 residues), 59.9 bits, see alignment E=1.4e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>mRNA_6514 KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter (Rhodosporidium toruloides IFO0880)
MAAAAPAGGSFLPSHSSSPSLPSRASFERKSSVDGKDARTLLNGGPTAPVSEGRTRRTIV
PVWMIVLGWIALSAVVILMNRDILVEKHFDHPVTLTTLHLIFQTCATRLLHRFTTLISGP
PPAEEYATVPLTDPSQPPEDGTEEHAALGKSAQLERWKRKSVEMDWDTWRRQILPIALLF
SLSLVLSNAAYLYCSVAFIHILKSFAPVAILLAAFAFRTKAVSLRLFGIVVMISAGVGIA
SYGEVDFSLVGFSIQMVAIAIEATRVTLIQILLNPSSAASTASPDSRPPAPAIATGMSPL
KSLYFFAPAGLAINLFFLLVLEGLPAVRAIPKLGAWTILSNASLTFALNLSAVMLIGVSA
MVLSLSKIIKDILMVVGPVLLMGENLTFMQFVGYAVATVGMVVYKFTPN