Protein Info for mRNA_6519 in Rhodosporidium toruloides IFO0880

Name: 14887
Annotation: K11806 WDSOF1 WD repeat and SOF domain-containing protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00400: WD40" amino acids 59 to 96 (38 residues), 20.5 bits, see alignment 1.1e-07 amino acids 248 to 292 (45 residues), 16.5 bits, see alignment 2e-06 amino acids 342 to 377 (36 residues), 26.6 bits, see alignment 1.3e-09 amino acids 402 to 420 (19 residues), 12.1 bits, see alignment (E = 4.7e-05) PF04158: Sof1" amino acids 421 to 498 (78 residues), 74.3 bits, see alignment E=1.2e-24

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>mRNA_6519 K11806 WDSOF1 WD repeat and SOF domain-containing protein 1 (Rhodosporidium toruloides IFO0880)
MKIKTMHRSLEDHLPTSSTSNAPVSRNLDPALHPFARTREYTRAVTAAKLERMFAKPFVA
SLEGHGDGIYCLTKDEAGGLGRVASGSGDGEVRVWDLGAQRTVWNVEGAHRGMIKGVAFS
HPMVGEEGRVEKKVGAGERGIKRKRTEIGYKGKGRAGLEDELEDEEYEDGLANLDATEAR
GSPRVLTCGVDKTVKLWDVKGASGKGARPLQTFTGKSGFHSISHHRYDPIFATGSTQIEI
WDETKTAPLSTLKFHTTSNSSSGEHVACVAFNKSETSVLASSGSDRTVCLYDLRSGKALG
RVAMQMRVNQLVFNPLQPPVLLCASEDHNLYTFDIRNLSTTTSVYKGHVGAVMSCDWSPT
GRDFVSASYDRTLRLWKQGEGKSRDTYHTKRMQRVFSTLYTLDSRFVLSGSDDANLRIWK
ARASEKLGVVDKREQVRKEYRDGLREKWGTVADVAKIERTRYLPKPIHKAASTKREMVDA
QRNKQEHRLKHAPKGVDPELLKPTAARKAAIQQVEQ