Protein Info for mRNA_6596 in Rhodosporidium toruloides IFO0880

Name: 14964
Annotation: K02898 RP-L26e, RPL26 large subunit ribosomal protein L26e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF16906: Ribosomal_L26" amino acids 5 to 118 (114 residues), 118.5 bits, see alignment E=1.4e-38 TIGR01080: ribosomal protein uL24" amino acids 6 to 118 (113 residues), 147.3 bits, see alignment E=1.1e-47 PF00467: KOW" amino acids 48 to 79 (32 residues), 31.9 bits, see alignment E=9.7e-12

Best Hits

Swiss-Prot: 58% identical to RL26_SCHPO: 60S ribosomal protein L26 (rpl26) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02898, large subunit ribosomal protein L26e (inferred from 58% identity to pno:SNOG_06909)

Predicted SEED Role

"LSU ribosomal protein L26e (L24p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>mRNA_6596 K02898 RP-L26e, RPL26 large subunit ribosomal protein L26e (Rhodosporidium toruloides IFO0880)
MAVTSISQRKAHKAHFGAPSSVRRILMSAPLSKELRAEHGVRSIPIRKDDEVKIVRGTYK
GREGRINTSNRKNFRVFVEGVSRDKGNGATVPIPVSASNVVITKIKMDKDRTALLKRKST
KKGEDVETK