Protein Info for mRNA_6604 in Rhodosporidium toruloides IFO0880

Name: 14972
Annotation: K12812 UAP56, BAT1, SUB2 ATP-dependent RNA helicase UAP56/SUB2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00270: DEAD" amino acids 83 to 251 (169 residues), 127.8 bits, see alignment E=6.1e-41 PF04851: ResIII" amino acids 98 to 246 (149 residues), 35.2 bits, see alignment E=2e-12 PF00271: Helicase_C" amino acids 290 to 397 (108 residues), 90.9 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 77% identical to SUB2_CRYNB: ATP-dependent RNA helicase SUB2 (SUB2) from Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)

KEGG orthology group: K12812, ATP-dependent RNA helicase UAP56/SUB2 [EC: 3.6.4.13] (inferred from 78% identity to mgl:MGL_3192)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>mRNA_6604 K12812 UAP56, BAT1, SUB2 ATP-dependent RNA helicase UAP56/SUB2 (Rhodosporidium toruloides IFO0880)
MASTLPTEDLIDYEEDVIEPSVAAPAAAAGGANGDDAAAGAGADDKQGKGSYVGVHSTGF
RDFLLKPELLRAISDLGFEHPSEVQQECIPQAILGMDVLCQAKSGMGKTAVFVTATLQQI
EPVDGEVSVIVLCHTRELAFQIKNEYARFSKYMPDVRTGVFYGGTSVKVDQDLLKNKEKC
PHIVVGTPGRLNALVRDKSLKAGSVRHFVLDECDKMLESLDMRRDIQEIFKATPHHKQVM
MFSATLAKEIRTTCKKFMQTPLEIYVDDEKKLTLHGLQQHFVRLEESAKNRKLNDLLDSL
EFNQVCIFVKSVSRAIELDRLLRECNFPSIAIHSGLNQEERIRRYQQFKAFEKRVLVATD
IFGRGIDVERVNIVINYDTPTDADSYLHRVGRAGRFGTKGLAITFVANDENEEVLKSIQS
RFEVAITELPETIEPSTYMNA