Protein Info for mRNA_6619 in Rhodosporidium toruloides IFO0880

Name: 14987
Annotation: KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 transmembrane" amino acids 572 to 591 (20 residues), see Phobius details TIGR00231: small GTP-binding protein domain" amino acids 243 to 362 (120 residues), 71 bits, see alignment E=5.2e-24 PF00025: Arf" amino acids 243 to 365 (123 residues), 49.1 bits, see alignment E=1.2e-16 PF09439: SRPRB" amino acids 245 to 308 (64 residues), 20.8 bits, see alignment E=5.7e-08 PF08477: Roc" amino acids 245 to 359 (115 residues), 107.5 bits, see alignment E=1.3e-34 PF00071: Ras" amino acids 245 to 362 (118 residues), 128.3 bits, see alignment E=5.4e-41 PF01926: MMR_HSR1" amino acids 245 to 344 (100 residues), 24.3 bits, see alignment E=7e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (714 amino acids)

>mRNA_6619 KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases (Rhodosporidium toruloides IFO0880)
MAAVVSPLPSPPLPSSPESLSSGSSNTASSNSCPPFPPPAAPFPTYTSFDSPKTKAFPPH
WSAPTASPAGSTSSRRHGRTSHRTAQSMSQPRDPSSFVAHEETHEEPATTSPPTTRRTHR
SSQSVSPTPISRTPSAEEVDSETPKRVPPRRSRTLSFSAAQQAFVPARPRLSHGVGSARA
FPFPRLEEGKVASSVALDRTSSTGSSSSVVLRPPRRSRTTLSTRTVPTSQRPAQPGAATD
YLEAKVVIVGSQGVGKTSLIHRSTTGKFNHSLSSTMGAGFLTKKLTIADTKVHFQLWDTA
GGERFRSLAKLYYRGALAAILVYDVTDESSLQDLKFWLQELRKNMSEDLIILVVGTKADL
AGSYPTIPLADAQRYVALCMHELGESSPDSTTSSTPARSREATPVARPPQVRNSFPSQPL
PTRTRTYSSPLLSNAEVPTITTTPPVSNANAPPAMTAFDDALISSRGRAVNRLAQATGPS
SHPPGQPPPTRSTQHTRPASLSSSMTLPDLSAYTLSGLANQPSAAHDSLTMVRSGSAGAA
ASGTSPTSSSGSPTANGSQISQNAGMSHSTSAFGLISFGSSLGDLVGASALSSRRRSQQD
DLHRFLQWPASSALPAPASSSTSLAASREARALESARIQQIVDDCPIEVVEVSAKDGFGI
EECFWTIAERLIERKEEIERRRVLRSRDSIVLREDDADAVAVAGVKGGAGACAC