Protein Info for mRNA_6725 in Rhodosporidium toruloides IFO0880

Name: 15093
Annotation: K07575 K07575 PUA domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF17832: Pre-PUA" amino acids 122 to 172 (51 residues), 59 bits, see alignment 6.5e-20 TIGR00451: uncharacterized domain 2" amino acids 145 to 259 (115 residues), 83.6 bits, see alignment E=5.4e-28 PF01472: PUA" amino acids 176 to 256 (81 residues), 60.6 bits, see alignment E=1.1e-20

Best Hits

Predicted SEED Role

"conserved protein with predicted RNA binding PUA domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>mRNA_6725 K07575 K07575 PUA domain protein (Rhodosporidium toruloides IFO0880)
MFKNFTPKEHIAGNAPMKSSAQRQIRAKLLEQIPFLSQPAAFPSTSSSAAPAAQPAPAAP
HSDDEDEEDSGKKKGKGGKKGKGAGPGGKGGKKGKKHDTEEEAPAAGAEEGAAAAVDEEL
TVLDLIWPKKETLSLIKCREHISIYAVHGEPLFFQHFDGPFYPTLKILHRFPDMLPRVGV
DRGAIKFVLSGANIMCPGMTSATGYLPPSSSNIPKGKPVAVHAYGKENALAIGLLAMSTD
EIREINKNIGVENITFLGDDLWKIEKL