Protein Info for mRNA_6736 in Rhodosporidium toruloides IFO0880

Name: 15104
Annotation: K11527 K11527 two-component system, sensor histidine kinase and response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 PF00512: HisKA" amino acids 194 to 260 (67 residues), 50.6 bits, see alignment E=2.5e-17 PF02518: HATPase_c" amino acids 307 to 421 (115 residues), 97.3 bits, see alignment E=1.2e-31 PF00072: Response_reg" amino acids 470 to 583 (114 residues), 89.5 bits, see alignment E=2.5e-29

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>mRNA_6736 K11527 K11527 two-component system, sensor histidine kinase and response regulator (Rhodosporidium toruloides IFO0880)
MAQGVGSTAERSGWKACGVVCDDCGCRARDSRATRCVAGQGADEGGPRRFRYLTLLTVDP
SFKITFFEGKTPPRLTGQSCDTIVGSPLLDFFPADELEAAVQKVLDGESENGFAESEVAT
RQGMMYHRYRLVPLRGDPSIPQSHPDYNAITGCIIVCADVTERKLADQALQKSRDESAKL
AASEVAAREANQLKTSFLTTISHEIRTPIAAILGICELLLADSNRLAPDQRNLVENAVQS
GELLLELVGAVLDVRKIETGELELETAPFLLSEALADARLFSIIAQKKGLEFVEDVGEFY
GGTLLADRLRLRQVLANALSNAVKFTKEGSVTLRCRQLSEDDTRIVVRFEIVDTGVGIDS
TVLPTLFHPFRQADASTAREYGGSGLGLTIAKKLVELMGGNITLDSTLGQGSRMIITIPL
QKAPLADVVDFVGTTQPLPAETPAEAKRLAKSEEVVKKVRKSRRPEDVRILLAEDNELIR
EIVTRTLRKKRFVVDAVADGRQCVEQVQRERYDCVLMDGQMPGLDGYHASQLIRQSPDPL
IRRLRIIALTASAIAGDRERCLSAGMDAYLAKPVRAAELEAAIWEQVELAENEHDEQNGV
DC