Protein Info for mRNA_6761 in Rhodosporidium toruloides IFO0880

Name: 15129
Annotation: K00944 AK3 nucleoside-triphosphate--adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 46 to 249 (204 residues), 197.2 bits, E=1.3e-62
• PF00406: ADK
  • amino acids 49 to 230 (182 residues), 133.9 bits, E=7.6e-43
• PF13207: AAA_17
  • amino acids 50 to 170 (121 residues), 68.7 bits, E=1.1e-22
• PF05191: ADK_lid
  • amino acids 170 to 205 (36 residues), 54.4 bits, 1.5e-18

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (268 amino acids)

>mRNA_6761 K00944 AK3 nucleoside-triphosphate--adenylate kinase (Rhodosporidium toruloides IFO0880)
MLAYPFSAARTASSRFGPALGRWSGCARRGLATVSKDDGQDGKKMRMILLGAPGAGKGTL
SDWLLERYEIDTIVVGQLLRNEITRGTRLGQVAERTMKQGALLQDELVLEVVQPAIEAKK
DKDWILDGFPRKKSQAVLLDEMLGKTGDELNLVASLKVPDQVIIERIEDRFIHLPSGRTY
NRKFNPPKVAGKDDVTGEPLSQRPDDDPAIVRKRLESFHHENDPLLAHYDGALVSFRGKT
SKEIWPHLSKAVEERFPNLPRRTTPRSP