Protein Info for mRNA_6779 in Rhodosporidium toruloides IFO0880

Name: 15147
Annotation: K10998 CSM3, SWI3 replication fork protection complex subunit Csm3/Swi3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF07962: Swi3" amino acids 142 to 214 (73 residues), 96.1 bits, see alignment E=5e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>mRNA_6779 K10998 CSM3, SWI3 replication fork protection complex subunit Csm3/Swi3 (Rhodosporidium toruloides IFO0880)
MFSSAASDADEPTYVSEKQRKATQRREALARLKDASSSRAARQPRFLGADDDDGDDTAGG
DVDFEQWERRDLAKRKRAPGGDSNAPSRNDPLLAGAFDDLFDLGETSGAAGEGKTDVDVD
GTGAEGIDVEGGTAKKRRIVAKLDETRLLGPSGFPRLRDDIKKVKIKGKGHEMQDLKRVL
TVYQLWSHQMYPKTNLRDTLQVVEKLCHKRTVQARSAFSFSSLSLSRLTALLIQRALKQY
RDEEKHGKVEADEAGEDDAFADLNLPKTGQDGAAPEADTPADTPAPPPDRAQMMHDAGFE
EEDDFFADEEALLAELDAQAREGALPAGQPNAGAPEQVAAGAEGVDEDDEAEAALREAEA
LLM