Protein Info for mRNA_6785 in Rhodosporidium toruloides IFO0880

Name: 15153
Annotation: K03860 PIGQ, GPI1 phosphatidylinositol glycan, class Q

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 203 to 222 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 400 to 429 (30 residues), see Phobius details amino acids 450 to 475 (26 residues), see Phobius details amino acids 481 to 506 (26 residues), see Phobius details amino acids 541 to 559 (19 residues), see Phobius details PF05024: Gpi1" amino acids 283 to 467 (185 residues), 181.1 bits, see alignment E=1.2e-57

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>mRNA_6785 K03860 PIGQ, GPI1 phosphatidylinositol glycan, class Q (Rhodosporidium toruloides IFO0880)
MSRRGTASLFVPDDLLERVLRASEVSPSECKRLFAAGRRQEGVAVVADFLEAADVDTAQA
ALRRRGAAGKQHGLDVVGEVMREGRAASNGVQRTPDLRFDWFCNQESPPDDETLSASPFI
ILYTPLRHLEALALAPLPLDFHPASFGRRDVAGNEAASTRGPASEQASSTLAIGIQLINI
LHQDSHTSLREADSSPKAPAAQVLYSLLLLVTAVLQGCVRILSVRLPLLGPLSERTAFAR
QLHTRFAQAASLLPMYFSLRRDLYGSGSAEARAQAHTTYIRFFNLVWLVANDFIVGMALA
SYVRDNAPFLKHLAEKLVRVYVLAYLRELLAWLSSWPMGVKLNDEVATVICGAFLFLSQL
WENVFLGPVLAHLPVHLIGLCGILGASSLLALTADLISLLTLPFFACYVAATLVYRWSLS
TLSALFNVFRGRKYNPLRSRVEPATYDVDALLLGTILFVTISFLFPTLVAFYLAFASSRL
LILSVQAVLLMGVSALNAFPLFALLLRFKSPRRLPGGVDLEACEDVRHWPERHLHLRSRP
VSYLAILSSLLVVFDEFLSPRGLLKVLGSLLSGRVIW