Protein Info for mRNA_6812 in Rhodosporidium toruloides IFO0880

Name: 15180
Annotation: K00074 paaH, hbd, fadB, mmgB 3-hydroxybutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02737: 3HCDH_N
  • amino acids 6 to 196 (191 residues), 174.8 bits, E=1.8e-55
• PF00725: 3HCDH
  • amino acids 199 to 295 (97 residues), 114.9 bits, E=2.2e-37

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 62% identity to scm:SCHCODRAFT_77841)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157

Use Curated BLAST to search for 1.1.1.157

Protein Sequence (298 amino acids)

>mRNA_6812 K00074 paaH, hbd, fadB, mmgB 3-hydroxybutyryl-CoA dehydrogenase (Rhodosporidium toruloides IFO0880)
ADGIDKVAVIGAGQMGIGISYVAAKTAGVDVLISDRSAQQITKGLQFVDTLLGKEVKKGK
MNNEEANRVRSRIKAASENGLQDGEFAEVDLVVEAVSENLAVKQTIFSQLATHLPPHAIL
ASNTSSISLSTLAASAIDQKTGQSRARQVVGFHFFNPVPVMKLVELIPALQTDPSVLDTA
RGFAERMGKTVTQSADTPGFISNRLLMPFINEAIIALETGVATKEDIDTTLKLGMNHPMG
PLTLADFIGLDTCLSIMEVLMRETGDSKYRPSVLLGRMVSAGYLGKKSGQGFYTYTAR