Protein Info for mRNA_6816 in Rhodosporidium toruloides IFO0880

Name: 15184
Annotation: K02437 gcvH, GCSH glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 37 to 154 (118 residues), 141.4 bits, E=8.6e-46
• PF01597: GCV_H
  • amino acids 37 to 155 (119 residues), 145.8 bits, E=3e-47

Best Hits

Swiss-Prot: 49% identical to GCSH_RAT: Glycine cleavage system H protein, mitochondrial (Gcsh) from Rattus norvegicus

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 64% identity to cne:CNN00460)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Protein Sequence (162 amino acids)

>mRNA_6816 K02437 gcvH, GCSH glycine cleavage system H protein (Rhodosporidium toruloides IFO0880)
MLRTAIRPIARTATLAHRQTLIRAPFPALTRSVVTKRYTVEHEWVAFDDSTGLGTIGITD
YAQKALGDVVYVEVSEQGTQVAKGEEMGAVESVKAASDIFAPVGGQIAEVNEALEDQPDL
LNKSPEQDGWLAKIKLSNPGEFDELLNEDAYKAHCAGSEEAS