Protein Info for mRNA_6884 in Rhodosporidium toruloides IFO0880

Name: 15252
Annotation: K00943 tmk, DTYMK dTMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00041: dTMP kinase
  • amino acids 12 to 198 (187 residues), 127.8 bits, E=2.1e-41
• PF02223: Thymidylate_kin
  • amino acids 18 to 198 (181 residues), 152.7 bits, E=4.8e-49

Best Hits

Swiss-Prot: 48% identical to KTHY_HUMAN: Thymidylate kinase (DTYMK) from Homo sapiens

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 55% identity to xtr:448574)

MetaCyc: 48% identical to thymidylate kinase (Homo sapiens)
T(2)-induced deoxynucleotide kinase. [EC: 2.7.4.12, 2.7.4.13, 2.7.4.9]

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (7/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (3/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.12 or 2.7.4.13 or 2.7.4.9

Protein Sequence (228 amino acids)

>mRNA_6884 K00943 tmk, DTYMK dTMP kinase (Rhodosporidium toruloides IFO0880)
MATTAAAPSRRRGAFIVFEGLDRSGKSTQVQRLVDALNARGVQTKGARFPDRTLSTGKMI
DSYLSQKADLDDRAIHLLFSANRWERASQILEDLRNGVTVVCDRYAFSGIAFSAIKGLSW
NWCRAPDVGLPQPDLVLFLRVSPEVAQQRGGFGQERYETSEVQAKVEKAFTKLGQSVGKD
VWTEIDADKGVDEVHEEIVRRVEQALGSEALDGEVKKLWEDALGDEKD