Protein Info for mRNA_6940 in Rhodosporidium toruloides IFO0880

Name: 15308
Annotation: KOG2816 Predicted transporter ADD1 (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 192 (28 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 449 to 473 (25 residues), see Phobius details amino acids 481 to 509 (29 residues), see Phobius details amino acids 515 to 534 (20 residues), see Phobius details PF07690: MFS_1" amino acids 106 to 368 (263 residues), 52.2 bits, see alignment E=2.4e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>mRNA_6940 KOG2816 Predicted transporter ADD1 (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MRAATMADRAEETVPTREISGSSDTRTKASAWWIIPPYFVFALLAGMTASIEVDLYGQIA
CRAVAASDGTFPQPTFPFLDSRVSKEQDEWMALCRSSPIVQKRTTSVVTTVLLVAGILSA
LTAAWWGSLSDRKGRKIVLAFISASETIQAIMMLLVLAFPQTFGFGFLLFMAAIAGLSGG
QLAAATIAAAYLGDTSQAASKTQLLSFYEASEFAGQAVGPLIGPLLMRSWKLGPATPYTL
SIFARLAYLAVIFLMPESLTPEKRKLSAVNTDGDDLASNKPATPLIKRLLAAPKELIEPF
RILLPEKVNGRRDYKLLLVASSYFFLMVIPGLGPVKVLYARAKFGWAPEQVGRWITYTSL
CKLVVLTAVIPLLIRLLRKSKTAAGTPDDDGQQVETQPLLGNQSPDAEQSKERRANMNWD
ASLALFGGITTVFGYLVATIPTKRPTAFLSSTALTAFAATSPPALQSIALTLAAPGDAGK
VLACLSAIATVSLSALGPTIFGAVNMIAIDRWPEAIFVVAAAWVLASLVPLLALRLSRK