Protein Info for mRNA_7022 in Rhodosporidium toruloides IFO0880

Name: 15390
Annotation: KOG0758 Mitochondrial carnitine-acylcarnitine carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 45 to 63 (19 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 192 to 203 (12 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF00153: Mito_carr" amino acids 44 to 124 (81 residues), 57.6 bits, see alignment E=5.1e-20 amino acids 137 to 232 (96 residues), 43.9 bits, see alignment E=9.6e-16 amino acids 243 to 328 (86 residues), 40.9 bits, see alignment E=7.8e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>mRNA_7022 KOG0758 Mitochondrial carnitine-acylcarnitine carrier protein (Rhodosporidium toruloides IFO0880)
MQSQTASEPVDDSSSPHPRSADSSTSTAAASNETWREFAYENRNTIAAVTASFCSTVAGF
PLDSVKSRLQVKRYSSVLDCARRTYAEEGIRGFFRGVTIPLVTITLVRTASFSIYTWTKD
DLQRRNVLTGETVGSTALAGFLGGAASGLLLSVGTTAFEYTKIKLQLEYLIAMKKGVPYV
PRGTIKGFLDLYRAGGILGLYTGFRLHALRDTLGTGLYFGMYDSAQHVIRNNPDVFENVP
TTLSIFICGSVAGVSSWAAIYPVDLVKAHTQRNALADLAYESPVSIFKRLSAGGVTKLYR
GLGVSAGRSVFTHGLMWTILEKTRSAIARRAGPEDSDARIE