Protein Info for mRNA_7047 in Rhodosporidium toruloides IFO0880

Name: 15415
Annotation: K07466 RFA1, RPA1, rpa replication factor A1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 PF04057: Rep-A_N" amino acids 7 to 94 (88 residues), 76 bits, see alignment E=4.2e-25 TIGR00617: replication factor-a protein 1 (rpa1)" amino acids 11 to 587 (577 residues), 630.8 bits, see alignment E=1.3e-193 PF01336: tRNA_anti-codon" amino acids 168 to 252 (85 residues), 41.1 bits, see alignment E=3e-14 PF16900: REPA_OB_2" amino acids 276 to 372 (97 residues), 112.5 bits, see alignment E=1.6e-36 PF08646: Rep_fac-A_C" amino acids 436 to 581 (146 residues), 161.7 bits, see alignment E=2.1e-51

Best Hits

Swiss-Prot: 39% identical to RFA1_XENLA: Replication protein A 70 kDa DNA-binding subunit (rpa1) from Xenopus laevis

KEGG orthology group: K07466, replication factor A1 (inferred from 46% identity to mgl:MGL_2931)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>mRNA_7047 K07466 RFA1, RPA1, rpa replication factor A1 (Rhodosporidium toruloides IFO0880)
MYESLDDPASVEPVLQVLSVKKVNASGAAATDRYRLILSDGEHFAQAMLTTTLNHYVSGD
SPDIVKNTIVKLPTYAVNVVQNRRIVIILSVEPVSHHPEKIGQPTSIETALQAQQPQADT
SMAEPAPAPAAAAPARPMAGSNATRGGGSLSDAPIYPIESLSPYQNKWTIKARVTSKSDI
RHWTNQRGEGKLFSVNLLDESGEIRATGFNEACDRLYPILEEHKVYRISRARVNIAKKQF
SNLNNEYEITFENNSEVEAVDEDSSVPKVQFNFVQLADLTSVDKDATCDVIGIVQDNGAV
SEITAKATQKQIKKRELTLVDRSQYACRVTLWGKQAESWNEVENGIVAIKAAKVGDFGGR
SLSVSGQSTVVVDPDIEEAHALRGWYDTQGQNQSFHSHSNAMGAGAGSANAFKPDAFKPL
KDVVDENLGMGEKPDYFATRATVTYVKGDNLSYPACPTDRCNKKMAQEGERQWRCDKCEM
TYEQPQYRYIISMCVNDYTSQIWVSGFNEVGQDLFGKTADEMQALKEDDDPAFQSTIANA
IGKCYNLNIKAKADSFGDQTRVRYQIQKIARVDWAQAAKTLAEQIEKW