Protein Info for mRNA_7050 in Rhodosporidium toruloides IFO0880

Name: 15418
Annotation: K08678 UXS1, uxs UDP-glucuronate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 133 to 367 (235 residues), 148.6 bits, E=4.4e-47
• PF16363: GDP_Man_Dehyd
  • amino acids 134 to 445 (312 residues), 171 bits, E=9.6e-54
• PF01073: 3Beta_HSD
  • amino acids 134 to 283 (150 residues), 32.1 bits, E=1.3e-11

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (3/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
• dTDP-β-D-fucofuranose biosynthesis (1/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (1/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (1/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (1/4 steps found)
• dTDP-α-D-mycaminose biosynthesis (1/5 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (1/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (1/5 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (1/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (2/7 steps found)
• dTDP-β-L-olivose biosynthesis (2/7 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (1/6 steps found)
• dTDP-D-desosamine biosynthesis (1/6 steps found)
• dTDP-L-daunosamine biosynthesis (1/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (2/8 steps found)
• dTDP-β-L-megosamine biosynthesis (2/8 steps found)
• dTDP-β-L-mycarose biosynthesis (1/7 steps found)
• dTDP-α-D-forosamine biosynthesis (2/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (2/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (1/11 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (3/19 steps found)
• novobiocin biosynthesis (2/19 steps found)
• superpathway of erythromycin biosynthesis (1/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)
• superpathway of megalomicin A biosynthesis (2/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (2/23 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Protein Sequence (457 amino acids)

>mRNA_7050 K08678 UXS1, uxs UDP-glucuronate decarboxylase (Rhodosporidium toruloides IFO0880)
MASPPLAHDPNRIPAPLQRAREHSRAPSVRSVGSTVDRDGRVIEEVGSPGESVPLELLQS
IYLSPNSPSPDTGSFPSSSGMTWTGTAHQRTESFSSDRYSPHNVPDWPSAVSFTSRTTFP
PVKKLPKAQKRRVLVTGGAGFVGSHLVDRLMFLGHDVVVLDNFFSGSKSTLSHWVGHPNF
ELVRGDVVEPLLIEVDQIYHLACPASPKAYQINAVKTLKTSFMGTLNMLGLAKRTKARFL
LSSTSEVYGSPTVHPQPESYWGNVNPNGPRSCYDEGKRVAEALTYGYARQDGVDVRVARI
FNCFGPRMSADDGRLVSNFVVAALKGEPLQVYGDGEATRSLMFVHDLISGLIALMESDYS
EGPVNIGSPDEGSVLSWASTILALVKDLRASGSIPPLPAGQKESEIEFVPAVVDDPPRRK
PDITLAKEVLAWEPRWTVMAGLEETIRYFAGQLAEGE