Protein Info for mRNA_7052 in Rhodosporidium toruloides IFO0880

Name: 15420
Annotation: K01624 FBA, fbaA fructose-bisphosphate aldolase, class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01520: fructose-bisphosphate aldolase, class II
  • amino acids 3 to 350 (348 residues), 584.8 bits, E=5.9e-180
• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 8 to 352 (345 residues), 350.6 bits, E=7e-109
• PF01116: F_bP_aldolase
  • amino acids 11 to 351 (341 residues), 319.1 bits, E=1.4e-99

Best Hits

Swiss-Prot: 68% identical to ALF_NEUCR: Fructose-bisphosphate aldolase (fba) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 78% identity to cnb:CNBB5380)

MetaCyc: 56% identical to fructose-bisphosphate aldolase class II (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.13

Protein Sequence (353 amino acids)

>mRNA_7052 K01624 FBA, fbaA fructose-bisphosphate aldolase, class II (Rhodosporidium toruloides IFO0880)
MLSPGVLTGKNLVKLMDYARENHFAIPAFNCTSSSTVVAALEAARDSKSPVIIQVSQGGA
AFFAGKGVANDKQQASIAGAVAAAHYVRSIAPTYGVPVVLHSDHCAKKLLQWFDGMLEAD
EAYYKEKGEPLFSSHMLDLSEESKEENIETCVKYFERMAKIDLWLEMEIGITGGEEDGVD
NTSVDNNSLYTQPEDILDIHNALSKISPMFSIAAGFGNVHGVYKPGNVKLRPELLEKHQK
YCHEQLKSKNPLPIYLVFHGGSGSSKDEITTAVKNGVVKMNVDTDTQWAYMIGFRDYFKS
KAAYLETQVGNPEGADKPNKKQYDPRVWVREGEKTMKERCQVAFKDLRSEGTL