Protein Info for mRNA_7054 in Rhodosporidium toruloides IFO0880

Name: 15422
Annotation: K14018 PLAA, DOA1, UFD3 phospholipase A-2-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 PF00400: WD40" amino acids 149 to 186 (38 residues), 30 bits, see alignment 1e-10 amino acids 189 to 227 (39 residues), 13.2 bits, see alignment 2.1e-05 amino acids 231 to 275 (45 residues), 27 bits, see alignment 9e-10 amino acids 279 to 318 (40 residues), 27.6 bits, see alignment 6e-10 PF09070: PFU" amino acids 405 to 514 (110 residues), 136.3 bits, see alignment E=8.6e-44 PF08324: PUL" amino acids 573 to 797 (225 residues), 165.3 bits, see alignment E=2.8e-52

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (809 amino acids)

>mRNA_7054 K14018 PLAA, DOA1, UFD3 phospholipase A-2-activating protein (Rhodosporidium toruloides IFO0880)
MASSHDSPAPQYRLSSTLAGHGADVRALSSAPRPHSSSPSHAPSSGGYDALHPVMFSSSR
DGTARSWIRKGVAEGMKGVGGGWSEGGVFGGAESKAGHEGFVNAVEWMPGTDGAEGGYLL
TGGQDKLIHAWPLPSPSSSSADSSASPNSPSHTLIGHEGNVCALHVSEDGRRIVSGSWDK
TARVWKDWQLAYTLKGHEQSVWAVLALDEPEDDLVLTGAADNLIRLFKADKLVKTFKGHT
QAVRALAKLDKSAGGGEGGDWFASGSNDGSIRLWSLLTGDCVHTLSGHDSFVYSLSAIPD
HLGGGLISGGEDRTVRVWRASDGECQQTIVVPAVSVWCVSVLANGDIAAGASDGLVRVYT
RNEERVASQEELASYEEQVAKTSLNSSQIGDLKKSDLPGPEALDQPGKKEGDVKMVKTVG
GTVEAYQWSAGSRSWQKVGEVTDAVGSSRKQLYQGQEYDHVFDVDLGGGAPILKLPYNAA
ENPYAAAQRFLFANDLPLGYLDEVASFIEKNTGGVKLGATGNVDPYTGASSYRSQGPSST
PAPSASGFSGDPFTGGGRSSAPAPVMPRGGGILPHRSFLTFAQANLPALRNKLSQLSEQF
AANPSTASLALSADDFAALDRLIAYLLVALTNPSSPSGAPPSDADTAVVDKLLSTWPPEQ
RFPALDLARLLSLFAPTPGSFPVILSTGSDPSESETNAMLALRALANVFMPVVGKATMQS
EARDVVAGLRRRGGQKALNKNGKVAFATVLLNFSVLATHKQLDTKAAEDIAELAVEMLKE
TDGEAVYRAMMALGNLVRLFLPKQRSAPC