Protein Info for mRNA_7056 in Rhodosporidium toruloides IFO0880

Name: 15424
Annotation: K01557 FAHD1 acylpyruvate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF01557: FAA_hydrolase" amino acids 15 to 204 (190 residues), 184.3 bits, see alignment E=1.4e-58

Best Hits

Swiss-Prot: 56% identical to FAHD1_DICDI: Acylpyruvase FAHD1, mitochondrial (fahd1) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 61% identity to cci:CC1G_10571)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>mRNA_7056 K01557 FAHD1 acylpyruvate hydrolase (Rhodosporidium toruloides IFO0880)
MSSIAAQFATRGKKCVAIGRNYAAHIKELNNTTPSEPFFFLKPTTSYALSDDGKVEIPKG
VVVHHEVELGVIIGKRGRDIPASKALDYVAGYTLAIDYTARNVQDAVKAKGLPWSAAKGF
DTFCPVGQFIPKDKVQDPHNLRLWYKVNDSTKQDDSTSLMLYRIPDLIAHVSGIMTLEEG
DLLLTGTPKGVGPVVAGDKVTAALETPEGTVLDRLEHLVKAREGGYEFKGKL