Protein Info for mRNA_7068 in Rhodosporidium toruloides IFO0880

Name: 15436
Annotation: K00167 BCKDHB, bkdA2 2-oxoisovalerate dehydrogenase E1 component beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF02779: Transket_pyr" amino acids 102 to 276 (175 residues), 131.7 bits, see alignment E=2.5e-42 PF02780: Transketolase_C" amino acids 292 to 424 (133 residues), 94.5 bits, see alignment E=4.6e-31

Best Hits

KEGG orthology group: K00167, 2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC: 1.2.4.4] (inferred from 65% identity to cci:CC1G_01195)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>mRNA_7068 K00167 BCKDHB, bkdA2 2-oxoisovalerate dehydrogenase E1 component beta subunit (Rhodosporidium toruloides IFO0880)
MLARTALRRGATLAGTQRRALSRSAPHSYSPANSKTAVALPPTVANSSLLRTSRDDALWT
PGLLWRDEEHVGVGRSEEAKRDRELKEDDLRPEEEGGRPTEKMNVYQAIRSALHTVLAKD
SSSLVFGEDVSFGGVFRCTMGLADQFGQERVFNTPLTEQGIAGFGIGLSTMGHTAVAEMQ
FADYIFPAFDQLVNDAKYRYRSGGMFNCGSLTIRSPCSAVGHGGLYHSQSPEAFFLQASG
LKIVVPRSPIQAKGLLLSAIRDPNPVLFLEPKILYRSAVEQVPTTDYELPLGQAEVLQEG
KDLTIVSYGPPLYTVETALHHLRQPDEDLEKLVPRDLRGLSVELIDLRTVMPYDIETIVK
SVNKTGRLMIVHEAPLAGSVASELAAEVQQRCFLRLEAPVKRLTGWDTPFGLAYEKFYLP
DHVRILDGIIETMRY