Protein Info for mRNA_7073 in Rhodosporidium toruloides IFO0880

Name: 15441
Annotation: HMMPfam-Domain of unknown function DUF77-PF01910,SUPERFAMILY--SSF89957,TIGRFAM-TIGR00106 uncharacterized protein, MTH1187 family-TIGR00106

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00106: uncharacterized protein, MTH1187 family" amino acids 4 to 99 (96 residues), 115.6 bits, see alignment E=6.2e-38 PF01910: Thiamine_BP" amino acids 5 to 96 (92 residues), 113.3 bits, see alignment E=2.1e-37

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>mRNA_7073 HMMPfam-Domain of unknown function DUF77-PF01910,SUPERFAMILY--SSF89957,TIGRFAM-TIGR00106 uncharacterized protein, MTH1187 family-TIGR00106 (Rhodosporidium toruloides IFO0880)
MHATADFCLVPMGTADPSVSKYIAECQRVLQKSGLKYELHGYGTGVEGEYSAVMKVIEEC
HEAVHAMGCPRVATDIRIGTRVDKQGSLQAKIDSVKELLSCAHSTSLRISGYLLTLSCSL
GARHAGKTSLRERSNSPRLPPSLRSFTSHRGPGHKRSRGGRAARSSSLMCIARALLSSPA
IVPIG