Protein Info for mRNA_7096 in Rhodosporidium toruloides IFO0880

Name: 15464
Annotation: K16729 CHORDC1, CHP1 cysteine and histidine-rich domain-containing protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04968: CHORD
  • amino acids 5 to 68 (64 residues), 89.2 bits, E=2.3e-29
  • amino acids 151 to 211 (61 residues), 92.9 bits, E=1.7e-30
• PF04969: CS
  • amino acids 230 to 305 (76 residues), 47.4 bits, E=3.3e-16

Best Hits

KEGG orthology group: None (inferred from 42% identity to pcs:Pc13g08480)

Predicted SEED Role

No annotation

Protein Sequence (356 amino acids)

>mRNA_7096 K16729 CHORDC1, CHP1 cysteine and histidine-rich domain-containing protein 1 (Rhodosporidium toruloides IFO0880)
MTLATCTRRGCGKSFDPEQNGDADCSFHPGAPVFHEGLKSWSCCSDVNKPVTDFDDFVKL
PTCATGSHSLEPAEPLKPVVEASKAPSTTDADGKEVYGAAVPQDSTSEDSSLPPLPPGPK
IAHKEGPQKPQSTPYVEEQDDPEVEVKKGMRCKRKACGKEFEGEDRQDGECRYHAGVPIF
HEGSKGYSCCKRRVLEFDEFLRIEGCRTGRHLFVGAKKEDDGKEELVDLRTDHYQTPRQV
IVSVFGKQADKEASVVKFESEAMHVDLVLPSRKRFTKSFPLYGPIDPSASSYKILGTKCE
ITLAKADARSWPSITTLDPELASKFQIQLAFSAGGGRGTVGAKEMVLDQTNAAKLK