Protein Info for mRNA_7097 in Rhodosporidium toruloides IFO0880

Name: 15465
Annotation: K03064 PSMC6, RPT4 26S proteasome regulatory subunit T4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR01242: 26S proteasome subunit P45 family" amino acids 31 to 387 (357 residues), 441.2 bits, see alignment E=1.6e-136 PF16450: Prot_ATP_ID_OB" amino acids 71 to 126 (56 residues), 39.5 bits, see alignment 1.4e-13 PF07728: AAA_5" amino acids 183 to 304 (122 residues), 28.4 bits, see alignment E=4.7e-10 PF05496: RuvB_N" amino acids 183 to 250 (68 residues), 23.2 bits, see alignment E=1.6e-08 PF00004: AAA" amino acids 184 to 317 (134 residues), 145.2 bits, see alignment E=4.7e-46 PF07724: AAA_2" amino acids 184 to 276 (93 residues), 26.6 bits, see alignment E=1.9e-09 PF17862: AAA_lid_3" amino acids 340 to 382 (43 residues), 45.7 bits, see alignment 1.4e-15

Best Hits

Swiss-Prot: 76% identical to PRS10_SCHPO: Probable 26S proteasome subunit rpt4 (rpt4) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K03064, 26S proteasome regulatory subunit T4 (inferred from 80% identity to cci:CC1G_09015)

Predicted SEED Role

"proteasome regulatory subunit Rpt4" in subsystem Proteasome eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>mRNA_7097 K03064 PSMC6, RPT4 26S proteasome regulatory subunit T4 (Rhodosporidium toruloides IFO0880)
MAEASSSASQPAQQFDPAKQQALAAYRKKLKEHEELDQNLKKIRLSLKDLERDYEKSEDD
IKALQSVGQIVGEVLKQLDEERFIVKASSGPRYVVGCRSAVPKHKLKNGVRVSLDMTTLT
IMRILPREVDPLVYNMTMEDPGSASFAGVGGLGDQIRELREVIELPLMNPELFMRVGIKP
PKGVLLYGPPGTGKTLLARAVAATLQTNFLKVVASAIVDKYIGESARLVREMFGYAKEHE
PCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDYLGKTKVIFATNRPDTLD
PALMRPGRIDRKIEIPLPNEVARMEILKIHAGPIRKSGEIDYEAIVKLSEGFNGADLRNI
CTEAGMFAIRDERDYCVQEDFLKGARKLQDAKKHETILEYDNV