Protein Info for mRNA_7102 in Rhodosporidium toruloides IFO0880

Name: 15470
Annotation: K03441 GLP-F aquaglyceroporin related protein, other eukaryote

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 784 transmembrane" amino acids 405 to 426 (22 residues), see Phobius details amino acids 432 to 458 (27 residues), see Phobius details amino acids 480 to 501 (22 residues), see Phobius details amino acids 541 to 560 (20 residues), see Phobius details amino acids 569 to 595 (27 residues), see Phobius details amino acids 622 to 643 (22 residues), see Phobius details PF00230: MIP" amino acids 399 to 637 (239 residues), 170.4 bits, see alignment E=2.6e-54 TIGR00861: MIP family channel proteins" amino acids 405 to 643 (239 residues), 191.3 bits, see alignment E=1.1e-60

Best Hits

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (784 amino acids)

>mRNA_7102 K03441 GLP-F aquaglyceroporin related protein, other eukaryote (Rhodosporidium toruloides IFO0880)
MSTPPERDQERPPHPPRPPSSHRHTASSTASTAAFPPLDASTSRATADSTAQQRRRASSA
SIAGPPPTQQNSRRRPARNDSTTSTAPSDAPSRRSDSIRAPPAAAAKKERPRPPNVAGPA
PIRRFSTIPDSLFAVSESDRTPGSNAGSELGRQLGGGGNDSMSIFPVEEGSVGSSVETGK
GKKPLWAVGGVFPKHLSKRRRSSVAQEQKKRRQNSQRNARASSSAAAAAPNRPAIPRDGT
YVTQSSVSSAAVDDEPAEVVAHDLDNEKPRERADPFEELRNATSNGSRNAPLEVVVSNDS
GRSEEERRRAEREASEERGEEQPQQLQKVNSGGSRTIAGEIDEERADDQGEKEGDAEAGQ
MPGGELDQNEGDWVDDFDAREGPNDELPIRNWWGTVRYALREPMAEFLGTMILVCIGIGS
TCQTKISDYTMGAYSSVSFAWGFAVMLALYIAGGISGGHCNPAVSITLAVFRGFPWKMVP
RYIVAQVLGAFVGGLMIYGNYRHAIDMYDPHKLIHSTPQANASATLFITSPASNVASPAE
GFCQEILAGGILMIAVLALGDENNAPPGAGLGAIVLGFVVVAIGMSNGWVSGYAINPARD
LGPRLALWCVGYGIKLWHHDSWWWLIGPICGAIVGSLAGALAYDLCCFTGSGSPINYTGQ
ELADAMRLHTMHNMVWMALSPNKRRARRQAIEANNPDALAESGMAPYAPDVFQPPVRRDH
PPGRATEKQREEADFTQRWRRGKEKVWQEEARARQRERELRREYRRSLEESRERDRRRVE
EWRQ