Protein Info for mRNA_7116 in Rhodosporidium toruloides IFO0880

Name: 15484
Annotation: K04393 CDC42 cell division control protein 42

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR00231: small GTP-binding protein domain" amino acids 1 to 157 (157 residues), 130.8 bits, see alignment E=2e-42 PF00025: Arf" amino acids 2 to 170 (169 residues), 26.8 bits, see alignment E=4.9e-10 PF08477: Roc" amino acids 5 to 118 (114 residues), 68.4 bits, see alignment E=1e-22 PF00071: Ras" amino acids 5 to 175 (171 residues), 179.5 bits, see alignment E=5.9e-57

Best Hits

Swiss-Prot: 89% identical to CDC42_SCHPO: Cell division control protein 42 homolog (cdc42) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K04393, cell division control protein 42 (inferred from 95% identity to uma:UM00295.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>mRNA_7116 K04393 CDC42 cell division control protein 42 (Rhodosporidium toruloides IFO0880)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDDPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQVDLR
DDPAVMEKLGRQKQRPVPPEAGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALEPP
VTKRKSKCSIL