Protein Info for mRNA_7124 in Rhodosporidium toruloides IFO0880

Name: 15492
Annotation: K02872 RP-L13Ae, RPL13A large subunit ribosomal protein L13Ae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR01077: ribosomal protein uL13" amino acids 7 to 150 (144 residues), 194 bits, see alignment E=7.7e-62 PF00572: Ribosomal_L13" amino acids 8 to 117 (110 residues), 40.2 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 66% identical to RL16_NEUCR: 60S ribosomal protein L16 (crp-46) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K02872, large subunit ribosomal protein L13Ae (inferred from 78% identity to cci:CC1G_06778)

Predicted SEED Role

"LSU ribosomal protein L13Ae (L13p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>mRNA_7124 K02872 RP-L13Ae, RPL13A large subunit ribosomal protein L13Ae (Rhodosporidium toruloides IFO0880)
MQSASPIVIDGKGHLLGRLASIVAKQLLNGQKVVVVRCEEINCSGSFFRAKLRYHEFLNK
RHLVNPKKSGPFHHRAPSRILYRTIRGMVPHKTSRGAAAMERLKVYEGVPPPYDRKKRVV
VPQALRVLRLKPGRKYCTIKRLSHEVGWSYRDVVDRLEEKRKVKAAAFHERKVASQKAQV
AALKAASKAAPISEKLAALGH