Protein Info for mRNA_7126 in Rhodosporidium toruloides IFO0880

Name: 15494
Annotation: K15122 SLC41A solute carrier family 41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 144 to 171 (28 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details PF01769: MgtE" amino acids 39 to 200 (162 residues), 72.2 bits, see alignment E=2.6e-24 amino acids 281 to 397 (117 residues), 66.8 bits, see alignment E=1.2e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>mRNA_7126 K15122 SLC41A solute carrier family 41 (Rhodosporidium toruloides IFO0880)
QTLPVLLFALAGAILAGELLQRLQSWRVFIRIEELFILVPILLNLKGNLEMNLAARFSTS
ANIGELDLRLTRRSLVLGNLALLQVQALLVSFVSGLLAFILGMASRKGVHHALQHPIYKP
GMVPGTAAGGADVTEALRGGYFEALLVLCVSMLAAGFSSGICGSFMCSTVIMCRRFRVNP
DNIATPLAAALGDLVTLVILGVLSSLFILFMGTIVSSLVFLALLGAIAANIVFVFRNAYV
QELLTMGWGPLFAAMAISSATGVILETYVNRYPGFALLGQVMTAISGASGSIFVSRISTA
LHTGRREHYSFTAAMLIVVTYPILLAFFGFVWATGQADVSAGFFPAYAVATAIQLVLTML
VAHQGSLLLWKLDYDPDVYALPLFSAAMDVSGQLLLVAAYAFSGTKTLETAVDDSQAGEV
AADGVVAVVEALRRRWTG