Protein Info for mRNA_7168 in Rhodosporidium toruloides IFO0880

Name: 15536
Annotation: HMMPfam-WD domain, G-beta repeat-PF00400,HMMPfam-PFU (PLAA family ubiquitin binding)-PF09070,PRINTS-G protein beta WD-40 repeat signature-PR00320,ProSiteProfiles-Trp-Asp (WD) repeats profile.-PS50082,ProSiteProfiles-Trp-Asp (WD) repeats circular profile.-PS50294,ProSiteProfiles-PFU domain profile.-PS51394,SMART-WD40 repeats-SM00320,SUPERFAMILY--SSF50978

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00400: WD40" amino acids 68 to 104 (37 residues), 24.6 bits, see alignment 3.7e-09 amino acids 164 to 205 (42 residues), 28.3 bits, see alignment 2.4e-10 amino acids 221 to 249 (29 residues), 12.8 bits, see alignment (E = 1.9e-05) PF09070: PFU" amino acids 332 to 448 (117 residues), 102.5 bits, see alignment E=1.7e-33

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>mRNA_7168 HMMPfam-WD domain, G-beta repeat-PF00400,HMMPfam-PFU (PLAA family ubiquitin binding)-PF09070,PRINTS-G protein beta WD-40 repeat signature-PR00320,ProSiteProfiles-Trp-Asp (WD) repeats profile.-PS50082,ProSiteProfiles-Trp-Asp (WD) repeats circular profile.-PS50294,ProSiteProfiles-PFU domain profile.-PS51394,SMART-WD40 repeats-SM00320,SUPERFAMILY--SSF50978 (Rhodosporidium toruloides IFO0880)
MFAPSLSPHLPYLLVSSAHRGTGLLARGFRTKVEDGRRKGEEDKAGYLATSGSDSLIQLY
SLSSPSSSPVQTLLGHAHNVCALHASRDGKRMVSASWDGTARVWRRRKAQEGHEEEGEGE
WMCERVLADHGAAVWDVLMLEEGGGESILTACADSRIRLFEGDKLRHLFKGHEGPVRSLC
VLLPEEADSTMFASGSNDGTIRLWDWRTGHALSILGQQGSFVYSLTAIPSLAGGGLASSG
EDGIIKIWNEKGKEEQQVLVPALSVWTLATLPNGDLACGCSDHMIWIFTRDEKWLAHEET
RRMYEERLESMRASKAPATPKPRVEGPATLEQPGKAEGEVKLIQINEQPVKAYQWDGTSW
VELGEVVDPASAASATPAVPSQPREKMLHDGVEYDYVFQIDIKEDEPPISLPFNLEDDPH
ATAAAFVEAHSLPSSYVERIVEFVRASTAA