Protein Info for mRNA_7178 in Rhodosporidium toruloides IFO0880

Name: 15546
Annotation: KOG0417 Ubiquitin-protein ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05743: UEV
  • amino acids 6 to 118 (113 residues), 22.4 bits, E=9.5e-09
• PF00179: UQ_con
  • amino acids 7 to 144 (138 residues), 157.9 bits, E=1.3e-50

Best Hits

Swiss-Prot: 49% identical to UB2D1_HUMAN: Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) from Homo sapiens

KEGG orthology group: K06689, ubiquitin-conjugating enzyme E2 D/E [EC: 6.3.2.19] (inferred from 49% identity to mmu:216080)

MetaCyc: 49% identical to ubiquitin-conjugating enzyme E2D2 (Homo sapiens)
RXN-15556 [EC: 2.3.2.23]

Predicted SEED Role

No annotation

MetaCyc Pathways

• protein ubiquitination (3/9 steps found)

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.19

Use Curated BLAST to search for 2.3.2.23 or 6.3.2.19

Protein Sequence (150 amino acids)

>mRNA_7178 KOG0417 Ubiquitin-protein ligase (Rhodosporidium toruloides IFO0880)
MSAAARRITKEYAELQADFPPHVQAAPDENNLLHWTGTITGPPDSAYKGGKFNIDITFPT
EYPFKSPTVKFTTRIYHPNVTDDGAICIGLLKSEAWKPSTKIEQILRALVQLLQEPNPDD
ALVASIAEVYNQDRATFNKNAQEWVKKYAS