Protein Info for mRNA_7215 in Rhodosporidium toruloides IFO0880
Name: 15583
Annotation: K10253 K10253 DOPA 4,5-dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to Y212_BOTFU: Uncharacterized 21.2 kDa protein from Botryotinia fuckeliana
KEGG orthology group: K10253, DOPA 4,5-dioxygenase [EC: 1.14.99.-] (inferred from 57% identity to scm:SCHCODRAFT_54494)Predicted SEED Role
"Aromatic ring-cleaving dioxygenase"
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Benzoate degradation via hydroxylation
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Naphthalene and anthracene degradation
- Nicotinate and nicotinamide metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.14.99.-
Use Curated BLAST to search for 1.14.99.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (185 amino acids)
>mRNA_7215 K10253 K10253 DOPA 4,5-dioxygenase (Rhodosporidium toruloides IFO0880) MSTVSYRDPLASLPAHLTPLAEDKNPDGKSLKNPARTDGRDRSEWYEGYPEELDTSNNAL DFHIYYASQAQTEHARRLHERIRREFPELRVYKFWEKPVGPHPVPMFEVNTFTPAQFGAF FGFLVAYRGDLSVLIHPNTHDSELLDHTTKATWMGPPYPLITSFLREHEGRFSGAPRQAA GGAAA