Protein Info for mRNA_7217 in Rhodosporidium toruloides IFO0880

Name: 15585
Annotation: KOG3309 Ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00111: Fer2" amino acids 44 to 126 (83 residues), 43.1 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 40% identical to FDX2_HUMAN: Ferredoxin-2, mitochondrial (FDX2) from Homo sapiens

KEGG orthology group: None (inferred from 65% identity to lbc:LACBIDRAFT_316884)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>mRNA_7217 KOG3309 Ferredoxin (Rhodosporidium toruloides IFO0880)
MPGALATGWQGALATRNFHATGVSAHGGKGRPKPGEGITLHFKKPNGEIVTVEANEGDDV
VDVSWEYDLDIEAACEKSVACSTCHVILEEKVYDSLPEPDDDENDMLDLAFGLTDTSRLG
CQVKVTKDMQDTTITLPSATRNLRVDGSKPTHH