Protein Info for mRNA_7237 in Rhodosporidium toruloides IFO0880

Name: 15605
Annotation: Hypothetical Protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 244 to 264 (21 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 444 to 467 (24 residues), see Phobius details amino acids 479 to 499 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (654 amino acids)

>mRNA_7237 Hypothetical Protein (Rhodosporidium toruloides IFO0880)
MIRYTPLPALLWSPLRRKEERETACSSLLLLLSLPLPVDSLATPLSSSLSCSPSWSPRSL
DRRASARVLLSRQVATIARLRERPLVALAPPRIPRILLPLPPFPRSVVPSSFSLAPFPPD
VCLHSPTTRTMETIASLPSAVDSLSSSLLSLPQQITTANLSLLSSLFHTLYSDLQPVLPT
LSSLQTETILTNSTFLSTNLAQLGSITAQIPPADTASASPADLVGIIEIGTTRYDILTFW
APEVWSIVIVYGIAAVLKGVLGVMMGRRAVRRAKEAIERREGEGKGGRVDGEVVKALLAS
PARAALGHALNATVATIALVLQCIAWRLFVLPSSPVRMSDIKYLSTAMKTLLIGYGCDML
FSDLRPEIFLHHFFTFALLLVGQLAAFETKSPKFFRLAQYLILQATAEQTTYGGMVAYHL
SKYYAVQDWRPRLQRSLLVTAHKLLVFTTWIAWPQKILPAAFALYWLGRMWNEIDHLPWG
RAWIVVCTVILSLLLTLQIKFCDDAIPLANYIGYKLYGGPFPSRVGPVMRILTLPFRRPH
RERTPSTLPLSTIVPSSSAPSEFSSTLKARSMEEGKMEQFNLPVLERESTKEERRSSTAS
RASVASSASSIAETLPGPSSIDTASISEVRPVSLDVRRPPLFDLADALRRPVSH