Protein Info for mRNA_7303 in Rhodosporidium toruloides IFO0880

Name: 15671
Annotation: KOG1269 SAM-dependent methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF13489: Methyltransf_23" amino acids 21 to 195 (175 residues), 50 bits, see alignment E=1.3e-16 PF07021: MetW" amino acids 39 to 141 (103 residues), 35.5 bits, see alignment E=3.3e-12 PF01209: Ubie_methyltran" amino acids 39 to 136 (98 residues), 48 bits, see alignment E=4.2e-16 PF13847: Methyltransf_31" amino acids 39 to 137 (99 residues), 67.1 bits, see alignment E=6.3e-22 PF08241: Methyltransf_11" amino acids 44 to 136 (93 residues), 70.3 bits, see alignment E=7.3e-23 PF08242: Methyltransf_12" amino acids 44 to 135 (92 residues), 38.3 bits, see alignment E=7.8e-13 PF13649: Methyltransf_25" amino acids 44 to 137 (94 residues), 66.3 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 48% identity to ske:Sked_10980)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>mRNA_7303 KOG1269 SAM-dependent methyltransferases (Rhodosporidium toruloides IFO0880)
MADADKHFYPSGHDSTVLRSHRTRNAANSAPHLLPHLRSTDSLLDIGCGPGTITCSLARH
VARVVGVEHPSAGEAILEGAREEAKTRGVADKVSFEFADALELPYEDDSFDVVYCHQVLQ
HVSDPIAVLREMRRVSRRLICAREADRGTMSLYPPDAAGSLARFDSLWYAVSRAGGGEPD
AGRRLKSWALAAGFEEGEVEVTAGTSTPDPREWGEMWSARVVKSDLATKAVELGLATREE
LEEMSRAWLEWSTKPDAWFGYVQGDLLAWKGGKR