Protein Info for mRNA_7329 in Rhodosporidium toruloides IFO0880

Name: 15697
Annotation: KOG0039 Ferric reductase, NADH/NADPH oxidase and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 90 to 113 (24 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 223 to 239 (17 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details PF01794: Ferric_reduct" amino acids 225 to 332 (108 residues), 51.6 bits, see alignment E=1.6e-17 PF08022: FAD_binding_8" amino acids 367 to 473 (107 residues), 39.5 bits, see alignment E=7.9e-14 PF08030: NAD_binding_6" amino acids 482 to 634 (153 residues), 49.4 bits, see alignment E=8.6e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>mRNA_7329 KOG0039 Ferric reductase, NADH/NADPH oxidase and related proteins (Rhodosporidium toruloides IFO0880)
MSVPAMDPLLFARGLVVELAAEHSRAHSGANASSSVVASVTATASAVAASSTGVAAAAAG
GAAAKGGGASSHGVSSVSAWNAAIARDFQYAFGLAVVLFLLFVTPLIAGWAANGRWRSGW
MMRTSAAEKAPSVAVNEKGGERSEKVKDAVVMDVFDRPALLKIVPTSVFVAHLRTLYNRI
LLRPFPLFHLTFGQIALCVVYEAVVVFCLFFKCLDHLSNFNRTAAVCVAQLPALFLFASK
NSALAVLGKGYEKMNYLHRVAGRLVVLCGLMHALFFLVKHPFDLSKPIQQSGMACVIACG
LLLIPSVSYIRNTFYQLFLLSHIAGWIAFLVGLYYHAPEFTTPYLIFCFVVYGLDVVTRV
AKTRLGKASIVSLPANTLMIQSHTISSGFRPGQHVWLRTWNVGGWWRGWETHPFTIASAP
DGASPLQGSHRLTLLVKAAGDYTKALNKKAEVSLGDSSAKVIGCAFEGPYGGPMLTDFAD
AQSVLLIAGGSGITFCAPLLEELVYLATVGKSSVRSVTLVWTMREAELIESYQAFLSGLV
DVAREKTALEVKISLHVTRAPLNLPHDTRVDANLPSPVPHSTLSLARPSISHTLDNVAGD
VVDSTTRMNLARGGGIVVGSCGPRGLVKEVRRAVGQVPVAKAVAVGGIVVCSETFGW