Protein Info for mRNA_7344 in Rhodosporidium toruloides IFO0880

Name: 15712
Annotation: K01697 E4.2.1.22, CBS cystathionine beta-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 13 to 329 (317 residues), 185.7 bits, E=6.8e-59

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 59% identity to scm:SCHCODRAFT_53905)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• L-cysteine biosynthesis VI (from L-methionine) (3/6 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Protein Sequence (387 amino acids)

>mRNA_7344 K01697 E4.2.1.22, CBS cystathionine beta-synthase (Rhodosporidium toruloides IFO0880)
MQTVPIHDSALSLIGHTPLVRLDRIAKEEGLKCNLLAKVEGFSAGGSVKDRIALRMVEEA
EKQGRLIPGVSVLVEPTSGNTGIGLALVAAVKGYRCIITMPEKMSKEKSNTLKALGAEIY
RTPTEAAWDSPESHISLAKRIVEETPNAVMLDQYNNPANPDAHYHTTASEILTSLSLVPS
TPSCPSSGTVDVLVAGAGTGGTLTGLSKRLREANPELVSLGVDPVGSVLARPEELNVLKE
GESAIYKVEGTGYDFVPAVLSHPDVTHWLKSTDSSSFTTCKRLIRTEGLLVGGSSGAAVH
AALEWLKGEEGWRVAGGVEGKNVVVVLPDSIRNYITSSWLNDDSPTASATQEADKSHSVA
TDLGDVDALTRKMSGLATHPDSAHGDA