Protein Info for mRNA_7353 in Rhodosporidium toruloides IFO0880

Name: 15721
Annotation: K00927 PGK, pgk phosphoglycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00162: PGK
  • amino acids 11 to 409 (399 residues), 497.5 bits, E=1.3e-153

Best Hits

Swiss-Prot: 73% identical to PGK_HYPRU: Phosphoglycerate kinase (pgk1) from Hypocrea rufa

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 75% identity to fgr:FG03992.1)

MetaCyc: 65% identical to phosphoglycerate kinase 1 (Homo sapiens)
Phosphoglycerate kinase. [EC: 2.7.2.3]

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• Bifidobacterium shunt (14/15 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Protein Sequence (421 amino acids)

>mRNA_7353 K00927 PGK, pgk phosphoglycerate kinase (Rhodosporidium toruloides IFO0880)
MPASLSNKLSIRDLDLKGKRVVMRVDFNVPFDGQGNITNNQRITAALPTVQYAIDQGAKS
IVLMSHLGRPNGSVVSKYSLKPVAAELERLLPGKTITFLPECVGAETEKRVAEAKDGEIF
LLENLRFHIEEEGSSKDKEGNKTKADAEKVKAFRASLTKLGDVFVNDAFGTAHRAHSSMV
GVDLPQKAAGLLMTKELEYFAKVLEKPERPFLAILGGAKVSDKIQLIENLLDKVDSLIVC
GGMAFTFKKTLDGVSIGNSLFDEPGSQKVKALVEKAKQKGVELVFPVDYITADKFDKDAN
TSTATDSEGIPDGWMGLDAGEESRKKFAETIKKAKTVLWNGPAGVFEFDKFAGGSKATLD
ACIAAKEAGATVIVGGGDTATVCAKYGAEDKLSHVSTGGGASLELLEGKDLPGVSALSEK
Q