Protein Info for mRNA_7361 in Rhodosporidium toruloides IFO0880

Name: 15729
Annotation: K14685 SLC40A1, FPN1 solute carrier family 40 (iron-regulated transporter), member 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 79 to 102 (24 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 141 to 168 (28 residues), see Phobius details amino acids 196 to 237 (42 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details amino acids 464 to 485 (22 residues), see Phobius details PF06963: FPN1" amino acids 40 to 475 (436 residues), 392.9 bits, see alignment E=8e-122

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>mRNA_7361 K14685 SLC40A1, FPN1 solute carrier family 40 (iron-regulated transporter), member 1 (Rhodosporidium toruloides IFO0880)
MMTGDTATELELEPTRTCSTARTSPDEGADTTQAVKVDNRALWSLLAQHLSSSWGARCYE
FASYLFLIRLFPNTTLQPSIFGFFTTGAAILFAGSVGHLVDIYPRLRFVRGSIVAQKATV
GASYAIFLACFLRLEGGRHTSALIGLFVVLTLLSMLLNLATIGISVAVERDWVTVIARGD
SNQLTRLNTFLRRIDLLSKLLAPLFVSLLTTAASYTFAAAFLLGFAAGSMVFEFIWIEIV
YRRLPVLAGAPTKATTAAAEEDVTALPNDSMPPRPLLRLKTRLIAEIQNWLTFIRAPIFF
SSLAISLLYLTVLSFDGSFLAWTKAHHYSDAFVAGMRGIGVVTGLLGTLVMPLLEKKIGL
VRAGTWSIFSEVVTLIPAVLAFFVKPPAEGKRGSALTDALLFTGMALSRIGLWSFDLCQL
KELQQALDSHPEKNALMALQFSLQNVLDLVKYIVTIILHRPSQFKWAVVISFASVTAGAL
SYLVYARKERGHLVHLEWTEALLRKTR