Protein Info for mRNA_7384 in Rhodosporidium toruloides IFO0880

Name: 15752
Annotation: K11128 GAR1, NOLA1 H/ACA ribonucleoprotein complex subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF04410: Gar1" amino acids 44 to 152 (109 residues), 120.7 bits, see alignment E=2.4e-39

Best Hits

Swiss-Prot: 63% identical to GAR1_BOTFB: H/ACA ribonucleoprotein complex subunit GAR1 (GAR1) from Botryotinia fuckeliana (strain B05.10)

KEGG orthology group: K11128, H/ACA ribonucleoprotein complex subunit 1 (inferred from 63% identity to bfu:BC1G_11335)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>mRNA_7384 K11128 GAR1, NOLA1 H/ACA ribonucleoprotein complex subunit 1 (Rhodosporidium toruloides IFO0880)
MSSRGGFRGGRGGGDRGGRGGGFRGGAGGRGGRGGGRGGFGGGRDDGPPAEVVEIGTFMH
AVEGEMLCSSTLPSKVPYFNAPIYLPSKAAIGKVDEILGPINEVYFTIKPSAGIVATSFT
AGDKVCISTDKLLPIERFLPQPKAPAGPKAKKRGGAAGGRGGRGGGFGGGRGGGFGGGGR
GRGAPRGRGAPGGGRGFGGGGRGGGRGAPRGRGRGGY