Protein Info for mRNA_7388 in Rhodosporidium toruloides IFO0880

Name: 15756
Annotation: K01951 guaA, GMPS GMP synthase (glutamine-hydrolysing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 28 to 228 (201 residues), 230.5 bits, E=1e-72
• PF00117: GATase
  • amino acids 30 to 223 (194 residues), 113.2 bits, E=3.5e-36
• PF07722: Peptidase_C26
  • amino acids 92 to 206 (115 residues), 27.9 bits, E=5e-10
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 236 to 558 (323 residues), 468.4 bits, E=1.1e-144
• PF02540: NAD_synthase
  • amino acids 249 to 317 (69 residues), 29.2 bits, E=1.3e-10
• PF00958: GMP_synt_C
  • amino acids 467 to 558 (92 residues), 144 bits, E=3.1e-46

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (559 amino acids)

>mRNA_7388 K01951 guaA, GMPS GMP synthase (glutamine-hydrolysing) (Rhodosporidium toruloides IFO0880)
MAAIAPPAGQEPAPAQLADSIVQSFDSILILDFGSQYSHLIVRRCREFNVYCEMLPCTQK
LADLKWKPKGIILSGSPFSVYEKDAPRVDPAVYDAGVPVLGICYGLQASRGDVETANHFG
ARVEASDHREYGEAIIKVLVQPPEAPAHLNKLFEGLPAESPVWMSHSDRLHSLPENFTTV
ATTESAPFAAIAHNEKPIYGIQFHPEVTHSLRGKDVLRRFVINICGCEQGWTMESFIDKE
IERIRTLVGPKGQVIGAVSGGVDSSVAAKLMHEAIGDRFHAIMVDNGVLRLNEAQQVHKM
LCEDLGVNLTVVDASDLFLGKLKGVTDPEQKRKIIGNTFIEVFEEKATEIEQQVKEAGGD
YGEIEWLLQGTLYPDVIESISFKGPSATIKTHHNVGGLLDDMKLKLIEPLRELFKDEVRA
LGRLLKIPEHLVGRHPFPGPGLAIRILGEVTREQVRIAQQADYIFIDEIRKAGLYDQISQ
AFCALLPVRAVGVQGDRRTYEQVICLRAVKTEDFMTADWFDFPPAVLRKMSNRITNEVQG
VNRVVMDITSKPPGTVEWL