Protein Info for mRNA_7391 in Rhodosporidium toruloides IFO0880

Name: 15759
Annotation: K00547 mmuM, BHMT2 homocysteine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02574: S-methyl_trans
  • amino acids 16 to 411 (396 residues), 143.6 bits, E=5.3e-46

Predicted SEED Role

"5-methyltetrahydrofolate--homocysteine methyltransferase (EC 2.1.1.13)" in subsystem Methionine Biosynthesis (EC 2.1.1.13)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• folate transformations II (plants) (8/11 steps found)
• folate transformations I (9/13 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• L-methionine salvage from L-homocysteine (1/3 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (10/18 steps found)
• aspartate superpathway (15/25 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.13

Protein Sequence (419 amino acids)

>mRNA_7391 K00547 mmuM, BHMT2 homocysteine S-methyltransferase (Rhodosporidium toruloides IFO0880)
MDSLFPQDSYGTRPVLVLDGGMGTTLQAPPFELGLDSALWSSELLATEDGRAQLERLHKT
WLGAGADIVETCTYQSSLPLFLPASPSSADQSTALSTMNAALPLAVSCCSSHASSSSRKP
TTALSLGPYGSALQPGQEYSGAYPPPFGPAETAAKDAKPACSQEALDLVPLPLDEVRAGL
ASTASDEEVHLAAWHLQRLQHFSQSPAFDEGIPLLAFETVPSLTEILAIRRAMHVFSTSS
SHSNSPKKTFYISLVFPRINEGTSAETVRFPDPSLAHLPTLADQAPLLVQAALEPREGYA
TPAGLGFNCTSPLHASFVVEALSSAIASSSLSKAQTKPWLVFYPDGGAIYDVQTRTWHHP
AGLTDDAWASLVADAVMVGREAGEGEVWGGVVVGGCCKAGPGAIRALKKEVVKRGWAKE