Protein Info for mRNA_7396 in Rhodosporidium toruloides IFO0880

Name: 15764
Annotation: K18584 ACTR3, ARP3 actin-related protein 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF00022: Actin" amino acids 5 to 426 (422 residues), 288 bits, see alignment E=5.1e-90

Best Hits

Swiss-Prot: 68% identical to ARP3_SCHPO: Actin-related protein 3 (act2) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 77% identity to cnb:CNBD1190)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>mRNA_7396 K18584 ACTR3, ARP3 actin-related protein 3 (Rhodosporidium toruloides IFO0880)
MSRLAPVVLDNGTGYTKMGFAGNSDPSFVIPTAIATRGSTSSTGRGPSVASKPAGLGSSS
GHLSSKRGIEDLDFYIGDEALANSKTYNVNYPIKHGQIEDWDQMERYWEQCIFKYLRAEP
EDHYFLLTEPPLNPPENREATAEIMFESFNVQGLYIAVQAVLALAASWTSKSVQHRTLTG
TVIDSGDGVTHVIPVAEGYVIGSAIRHIPIAGRDISSFVQQLLRDRNETGIPPEDSLRVA
EKIKEDYSYVCGDMVKEFGKYDREPEKFFAKYEGEHSVTGRKYSVDVGYERFLAPEIFFN
PEIYSSDFLTPLPDVVDQVIQTSPIDVRRGLYSNIVLSGGSTMFDHFGRRLQRDLKGIVD
QRIASSELASGSLMRSSGVDVNVISHKKQRYAVWFGGSLLASTPEFYGYCHDRTAYQEYG
PSLVRRFAIFGSATD