Protein Info for mRNA_7506 in Rhodosporidium toruloides IFO0880

Name: 15874
Annotation: K15102 SLC25A3, PHC, PIC solute carrier family 25 (mitochondrial phosphate transporter), member 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 273 to 273 (1 residues), see Phobius details amino acids 275 to 289 (15 residues), see Phobius details PF00153: Mito_carr" amino acids 15 to 100 (86 residues), 58 bits, see alignment E=3.7e-20 amino acids 120 to 198 (79 residues), 44.4 bits, see alignment E=6.4e-16 amino acids 218 to 298 (81 residues), 31.5 bits, see alignment E=6.7e-12

Best Hits

Swiss-Prot: 48% identical to MPCP_YEAST: Mitochondrial phosphate carrier protein (MIR1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 64% identity to cne:CNB03150)

MetaCyc: 48% identical to mitochondrial phosphate carrier protein (Saccharomyces cerevisiae S288C)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>mRNA_7506 K15102 SLC25A3, PHC, PIC solute carrier family 25 (mitochondrial phosphate transporter), member 3 (Rhodosporidium toruloides IFO0880)
MSYIPEIPTLTGLDYAKFFASGAACCLLSHGGMVPIDVVKTRMQLEPQLKKLGMVGTARH
IAAEEGVRGFATGFGSTAVGYFFQGGAKFALYDFFKKELAEASGSYENAVRNRTAIYLGG
AAIAEFFADILLTPLEAVRIRLVSDRKYATNLATGFKRMASEGGVKELYAGFVPILAKQI
PYAVGQFLVNELAHEAVYRQLSPEKRASLTTGEQTTITLGCGITAGFAAAILSQPADTLL
SQINKGHGGKGSAASKLIVLAKQAGPIGLFAGLGPRMLMTAGLVSSQFYLYSLIKNALGA
GKGVEIHKD